Anti RHBDL3 pAb (ATL-HPA059607)
Atlas Antibodies
- SKU:
- ATL-HPA059607-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RHBDL3
Alternative Gene Name: RHBDL4, VRHO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017692: 92%, ENSRNOG00000005515: 92%
Entrez Gene ID: 162494
Uniprot ID: P58872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS |
Gene Sequence | QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS |
Gene ID - Mouse | ENSMUSG00000017692 |
Gene ID - Rat | ENSRNOG00000005515 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RHBDL3 pAb (ATL-HPA059607) | |
Datasheet | Anti RHBDL3 pAb (ATL-HPA059607) Datasheet (External Link) |
Vendor Page | Anti RHBDL3 pAb (ATL-HPA059607) at Atlas Antibodies |
Documents & Links for Anti RHBDL3 pAb (ATL-HPA059607) | |
Datasheet | Anti RHBDL3 pAb (ATL-HPA059607) Datasheet (External Link) |
Vendor Page | Anti RHBDL3 pAb (ATL-HPA059607) |