Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045074-25

• 
• 

Protein Description: rhomboid domain containing 2
Gene Name: RHBDD2
Alternative Gene Name: NPD007, RHBDL7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039917: 84%, ENSRNOG00000001443: 79%
Entrez Gene ID: 57414
Uniprot ID: Q6NTF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
• Gene Sequence: HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
• Gene ID - Mouse: ENSMUSG00000039917
• Gene ID - Rat: ENSRNOG00000001443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.