Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA045074-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RHBDD2
Alternative Gene Name: NPD007, RHBDL7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039917: 84%, ENSRNOG00000001443: 79%
Entrez Gene ID: 57414
Uniprot ID: Q6NTF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP |
Gene Sequence | HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP |
Gene ID - Mouse | ENSMUSG00000039917 |
Gene ID - Rat | ENSRNOG00000001443 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) | |
Datasheet | Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) | |
Datasheet | Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RHBDD2 pAb (ATL-HPA045074 w/enhanced validation) |