Anti RGS9BP pAb (ATL-HPA049791)

Atlas Antibodies

SKU: ATL-HPA049791-25

• 

Protein Description: regulator of G protein signaling 9 binding protein
Gene Name: RGS9BP
Alternative Gene Name: FLJ45744, PERRS, R9AP, RGS9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056043: 87%, ENSRNOG00000012877: 84%
Entrez Gene ID: 388531
Uniprot ID: Q6ZS82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDGLNKTTACYHHLVLTVGGSADSQDLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEAD
• Gene Sequence: LDGLNKTTACYHHLVLTVGGSADSQDLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEAD
• Gene ID - Mouse: ENSMUSG00000056043
• Gene ID - Rat: ENSRNOG00000012877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.