Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045780-25
  • Immunohistochemical staining of human bone marrow shows strong nuclear positivity in megakaryocytes.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and RGS18 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408941).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: regulator of G-protein signaling 18
Gene Name: RGS18
Alternative Gene Name: RGS13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026357: 83%, ENSRNOG00000003959: 78%
Entrez Gene ID: 64407
Uniprot ID: Q9NS28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
Gene Sequence LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES
Gene ID - Mouse ENSMUSG00000026357
Gene ID - Rat ENSRNOG00000003959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation)
Datasheet Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation)
Datasheet Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RGS18 pAb (ATL-HPA045780 w/enhanced validation)