Anti RGS14 pAb (ATL-HPA046847 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046847-25

• 

Protein Description: regulator of G-protein signaling 14
Gene Name: RGS14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052087: 96%, ENSRNOG00000015616: 94%
Entrez Gene ID: 10636
Uniprot ID: O43566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP
• Gene Sequence: LTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKP
• Gene ID - Mouse: ENSMUSG00000052087
• Gene ID - Rat: ENSRNOG00000015616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.