Anti RGS12 pAb (ATL-HPA054646)

Atlas Antibodies

SKU: ATL-HPA054646-25

• 

Protein Description: regulator of G-protein signaling 12
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 95%, ENSRNOG00000030568: 95%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE
• Gene Sequence: VFMVDPDLFNHKIHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFHQE
• Gene ID - Mouse: ENSMUSG00000029101
• Gene ID - Rat: ENSRNOG00000030568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RGS12 pAb (ATL-HPA054646) – 1 Found

Yuan, Gongsheng; Yang, Shuting; Yang, Shuying. RGS12 represses oral squamous cell carcinoma by driving M1 polarization of tumor-associated macrophages via controlling ciliary MYCBP2/KIF2A signaling. International Journal Of Oral Science. 2023;15(1):11.