Anti RGPD5 pAb (ATL-HPA045704)

Atlas Antibodies

SKU: ATL-HPA045704-25

• 

Protein Description: RANBP2-like and GRIP domain containing 5
Gene Name: RGPD5
Alternative Gene Name: BS-63, DKFZp686I1842, RGP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042508: 27%, ENSRNOG00000018144: 27%
Entrez Gene ID: 84220
Uniprot ID: Q99666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
• Gene Sequence: APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
• Gene ID - Mouse: ENSMUSG00000042508
• Gene ID - Rat: ENSRNOG00000018144
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.