Anti RGL2 pAb (ATL-HPA047039)

Atlas Antibodies

SKU:
ATL-HPA047039-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ral guanine nucleotide dissociation stimulator like 2
Gene Name: RGL2
Alternative Gene Name: HKE1.5, KE1.5, RAB2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041354: 79%, ENSRNOG00000000474: 79%
Entrez Gene ID: 5863
Uniprot ID: O15211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWA
Gene Sequence FDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWA
Gene ID - Mouse ENSMUSG00000041354
Gene ID - Rat ENSRNOG00000000474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RGL2 pAb (ATL-HPA047039)
Datasheet Anti RGL2 pAb (ATL-HPA047039) Datasheet (External Link)
Vendor Page Anti RGL2 pAb (ATL-HPA047039) at Atlas Antibodies

Documents & Links for Anti RGL2 pAb (ATL-HPA047039)
Datasheet Anti RGL2 pAb (ATL-HPA047039) Datasheet (External Link)
Vendor Page Anti RGL2 pAb (ATL-HPA047039)