Anti RGCC pAb (ATL-HPA063701)

Atlas Antibodies

SKU: ATL-HPA063701-25

• 

Protein Description: regulator of cell cycle
Gene Name: RGCC
Alternative Gene Name: bA157L14.2, C13orf15, RGC-32, RGC32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022018: 94%, ENSRNOG00000042960: 94%
Entrez Gene ID: 28984
Uniprot ID: Q9H4X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
• Gene Sequence: LSDALCEFDAVLADFASPFHERHFHYEEHLERMK
• Gene ID - Mouse: ENSMUSG00000022018
• Gene ID - Rat: ENSRNOG00000042960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.