Protein Description: regulator of cell cycle
Gene Name: RGCC
Alternative Gene Name: bA157L14.2, C13orf15, RGC-32, RGC32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022018: 94%, ENSRNOG00000042960: 94%
Entrez Gene ID: 28984
Uniprot ID: Q9H4X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RGCC
Alternative Gene Name: bA157L14.2, C13orf15, RGC-32, RGC32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022018: 94%, ENSRNOG00000042960: 94%
Entrez Gene ID: 28984
Uniprot ID: Q9H4X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSDALCEFDAVLADFASPFHERHFHYEEHLERMK |
| Documents & Links for Anti RGCC pAb (ATL-HPA063701) | |
| Datasheet | Anti RGCC pAb (ATL-HPA063701) Datasheet (External Link) |
| Vendor Page | Anti RGCC pAb (ATL-HPA063701) at Atlas |
| Documents & Links for Anti RGCC pAb (ATL-HPA063701) | |
| Datasheet | Anti RGCC pAb (ATL-HPA063701) Datasheet (External Link) |
| Vendor Page | Anti RGCC pAb (ATL-HPA063701) |