Anti RFXANK pAb (ATL-HPA053330)

Atlas Antibodies

SKU: ATL-HPA053330-25

• 

Protein Description: regulatory factor X-associated ankyrin-containing protein
Gene Name: RFXANK
Alternative Gene Name: ANKRA1, BLS, F14150_1, MGC138628, RFX-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036120: 90%, ENSRNOG00000033318: 94%
Entrez Gene ID: 8625
Uniprot ID: O14593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEW
• Gene Sequence: HQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEW
• Gene ID - Mouse: ENSMUSG00000036120
• Gene ID - Rat: ENSRNOG00000033318
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.