Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA048969-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RFX2
Alternative Gene Name: FLJ14226
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024206: 80%, ENSRNOG00000045846: 80%
Entrez Gene ID: 5990
Uniprot ID: P48378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI |
Gene Sequence | VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI |
Gene ID - Mouse | ENSMUSG00000024206 |
Gene ID - Rat | ENSRNOG00000045846 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) | |
Datasheet | Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) | |
Datasheet | Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) |
Citations for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) – 3 Found |
Wallmeier, Julia; Bracht, Diana; Alsaif, Hessa S; Dougherty, Gerard W; Olbrich, Heike; Cindric, Sandra; Dzietko, Mark; Heyer, Christoph; Teig, Norbert; Thiels, Charlotte; Faqeih, Eissa; Al-Hashim, Aqeela; Khan, Sameena; Mogarri, Ibrahim; Almannai, Mohammed; Al Otaibi, Wadha; Alkuraya, Fowzan S; Koerner-Rettberg, Cordula; Omran, Heymut. Mutations in TP73 cause impaired mucociliary clearance and lissencephaly. American Journal Of Human Genetics. 2021;108(7):1318-1329. PubMed |
Lemeille, Sylvain; Paschaki, Marie; Baas, Dominique; Morlé, Laurette; Duteyrat, Jean-Luc; Ait-Lounis, Aouatef; Barras, Emmanuèle; Soulavie, Fabien; Jerber, Julie; Thomas, Joëlle; Zhang, Yong; Holtzman, Michael J; Kistler, W Stephen; Reith, Walter; Durand, Bénédicte. Interplay of RFX transcription factors 1, 2 and 3 in motile ciliogenesis. Nucleic Acids Research. 2020;48(16):9019-9036. PubMed |
Mattis, Katia K; Krentz, Nicole A J; Metzendorf, Christoph; Abaitua, Fernando; Spigelman, Aliya F; Sun, Han; Ikle, Jennifer M; Thaman, Swaraj; Rottner, Antje K; Bautista, Austin; Mazzaferro, Eugenia; Perez-Alcantara, Marta; Manning Fox, Jocelyn E; Torres, Jason M; Wesolowska-Andersen, Agata; Yu, Grace Z; Mahajan, Anubha; Larsson, Anders; MacDonald, Patrick E; Davies, Benjamin; den Hoed, Marcel; Gloyn, Anna L. Loss of RREB1 in pancreatic beta cells reduces cellular insulin content and affects endocrine cell gene expression. Diabetologia. 2023;66(4):674-694. PubMed |