Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048969-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA048969 antibody. Corresponding RFX2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
  • Western blot analysis in human cell line SCLC-21H.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: regulatory factor X, 2 (influences HLA class II expression)
Gene Name: RFX2
Alternative Gene Name: FLJ14226
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024206: 80%, ENSRNOG00000045846: 80%
Entrez Gene ID: 5990
Uniprot ID: P48378
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI
Gene Sequence VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI
Gene ID - Mouse ENSMUSG00000024206
Gene ID - Rat ENSRNOG00000045846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation)
Datasheet Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation)
Datasheet Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation)



Citations for Anti RFX2 pAb (ATL-HPA048969 w/enhanced validation) – 3 Found
Wallmeier, Julia; Bracht, Diana; Alsaif, Hessa S; Dougherty, Gerard W; Olbrich, Heike; Cindric, Sandra; Dzietko, Mark; Heyer, Christoph; Teig, Norbert; Thiels, Charlotte; Faqeih, Eissa; Al-Hashim, Aqeela; Khan, Sameena; Mogarri, Ibrahim; Almannai, Mohammed; Al Otaibi, Wadha; Alkuraya, Fowzan S; Koerner-Rettberg, Cordula; Omran, Heymut. Mutations in TP73 cause impaired mucociliary clearance and lissencephaly. American Journal Of Human Genetics. 2021;108(7):1318-1329.  PubMed
Lemeille, Sylvain; Paschaki, Marie; Baas, Dominique; Morlé, Laurette; Duteyrat, Jean-Luc; Ait-Lounis, Aouatef; Barras, Emmanuèle; Soulavie, Fabien; Jerber, Julie; Thomas, Joëlle; Zhang, Yong; Holtzman, Michael J; Kistler, W Stephen; Reith, Walter; Durand, Bénédicte. Interplay of RFX transcription factors 1, 2 and 3 in motile ciliogenesis. Nucleic Acids Research. 2020;48(16):9019-9036.  PubMed
Mattis, Katia K; Krentz, Nicole A J; Metzendorf, Christoph; Abaitua, Fernando; Spigelman, Aliya F; Sun, Han; Ikle, Jennifer M; Thaman, Swaraj; Rottner, Antje K; Bautista, Austin; Mazzaferro, Eugenia; Perez-Alcantara, Marta; Manning Fox, Jocelyn E; Torres, Jason M; Wesolowska-Andersen, Agata; Yu, Grace Z; Mahajan, Anubha; Larsson, Anders; MacDonald, Patrick E; Davies, Benjamin; den Hoed, Marcel; Gloyn, Anna L. Loss of RREB1 in pancreatic beta cells reduces cellular insulin content and affects endocrine cell gene expression. Diabetologia. 2023;66(4):674-694.  PubMed