Anti RFPL4A pAb (ATL-HPA046368)

Atlas Antibodies

SKU: ATL-HPA046368-25

• 
• 

Protein Description: ret finger protein-like 4A
Gene Name: RFPL4A
Alternative Gene Name: RFPL4, RNF210
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035191: 56%, ENSRNOG00000015743: 53%
Entrez Gene ID: 342931
Uniprot ID: A6NLU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK
• Gene Sequence: PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK
• Gene ID - Mouse: ENSMUSG00000035191
• Gene ID - Rat: ENSRNOG00000015743
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.