Anti RFLNB pAb (ATL-HPA060388 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060388-25

• 

Protein Description: refilin B
Gene Name: RFLNB
Alternative Gene Name: Cfm1, FAM101B, MGC45871, RefilinB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020846: 88%, ENSRNOG00000006674: 88%
Entrez Gene ID: 359845
Uniprot ID: Q8N5W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVP
• Gene Sequence: EGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVP
• Gene ID - Mouse: ENSMUSG00000020846
• Gene ID - Rat: ENSRNOG00000006674
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.