Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049123-25
  • Immunohistochemistry analysis in human testis and kidney tissues using Anti-RFC4 antibody. Corresponding RFC4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis using Anti-RFC4 antibody HPA049123 (A) shows similar pattern to independent antibody HPA058507 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: replication factor C (activator 1) 4, 37kDa
Gene Name: RFC4
Alternative Gene Name: A1, RFC37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022881: 90%, ENSRNOG00000001816: 91%
Entrez Gene ID: 5984
Uniprot ID: P35249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP
Gene Sequence RIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIP
Gene ID - Mouse ENSMUSG00000022881
Gene ID - Rat ENSRNOG00000001816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation)
Datasheet Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation)
Datasheet Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RFC4 pAb (ATL-HPA049123 w/enhanced validation)