Anti RFC1 pAb (ATL-HPA046116)
Atlas Antibodies
- SKU:
- ATL-HPA046116-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RFC1
Alternative Gene Name: A1, MHCBFB, PO-GA, RFC140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 81%, ENSRNOG00000002855: 81%
Entrez Gene ID: 5981
Uniprot ID: P35251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI |
Gene Sequence | QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI |
Gene ID - Mouse | ENSMUSG00000029191 |
Gene ID - Rat | ENSRNOG00000002855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RFC1 pAb (ATL-HPA046116) | |
Datasheet | Anti RFC1 pAb (ATL-HPA046116) Datasheet (External Link) |
Vendor Page | Anti RFC1 pAb (ATL-HPA046116) at Atlas Antibodies |
Documents & Links for Anti RFC1 pAb (ATL-HPA046116) | |
Datasheet | Anti RFC1 pAb (ATL-HPA046116) Datasheet (External Link) |
Vendor Page | Anti RFC1 pAb (ATL-HPA046116) |
Citations for Anti RFC1 pAb (ATL-HPA046116) – 1 Found |
Cui, Ye; Keles, Sevgi; Charbonnier, Louis-Marie; Julé, Amélie M; Henderson, Lauren; Celik, Seyma Celikbilek; Reisli, Ismail; Shen, Chen; Xie, Wen Jun; Schmitz-Abe, Klaus; Wu, Hao; Chatila, Talal A. Combined immunodeficiency caused by a loss-of-function mutation in DNA polymerase delta 1. The Journal Of Allergy And Clinical Immunology. 2020;145(1):391-401.e8. PubMed |