Anti REV3L pAb (ATL-HPA064853)

Atlas Antibodies

SKU: ATL-HPA064853-25

• 

Protein Description: REV3-like, polymerase (DNA directed), zeta, catalytic subunit
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 84%, ENSRNOG00000000593: 78%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQ
• Gene Sequence: KLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQ
• Gene ID - Mouse: ENSMUSG00000019841
• Gene ID - Rat: ENSRNOG00000000593
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.