Protein Description: REV3-like, polymerase (DNA directed), zeta, catalytic subunit
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 84%, ENSRNOG00000000593: 78%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 84%, ENSRNOG00000000593: 78%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQ |
| Documents & Links for Anti REV3L pAb (ATL-HPA064853) | |
| Datasheet | Anti REV3L pAb (ATL-HPA064853) Datasheet (External Link) |
| Vendor Page | Anti REV3L pAb (ATL-HPA064853) at Atlas |
| Documents & Links for Anti REV3L pAb (ATL-HPA064853) | |
| Datasheet | Anti REV3L pAb (ATL-HPA064853) Datasheet (External Link) |
| Vendor Page | Anti REV3L pAb (ATL-HPA064853) |