Anti RESP18 pAb (ATL-HPA045849)
Atlas Antibodies
- SKU:
- ATL-HPA045849-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RESP18
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022016: 26%, ENSRNOG00000005133: 28%
Entrez Gene ID: 389075
Uniprot ID: Q5W5W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATS |
Gene Sequence | PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATS |
Gene ID - Mouse | ENSMUSG00000022016 |
Gene ID - Rat | ENSRNOG00000005133 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RESP18 pAb (ATL-HPA045849) | |
Datasheet | Anti RESP18 pAb (ATL-HPA045849) Datasheet (External Link) |
Vendor Page | Anti RESP18 pAb (ATL-HPA045849) at Atlas Antibodies |
Documents & Links for Anti RESP18 pAb (ATL-HPA045849) | |
Datasheet | Anti RESP18 pAb (ATL-HPA045849) Datasheet (External Link) |
Vendor Page | Anti RESP18 pAb (ATL-HPA045849) |