Anti RER1 pAb (ATL-HPA051400)

Atlas Antibodies

SKU: ATL-HPA051400-25

• 

Protein Description: retention in endoplasmic reticulum sorting receptor 1
Gene Name: RER1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029048: 100%, ENSRNOG00000014270: 100%
Entrez Gene ID: 11079
Uniprot ID: O15258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK
• Gene Sequence: LSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK
• Gene ID - Mouse: ENSMUSG00000029048
• Gene ID - Rat: ENSRNOG00000014270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RER1 pAb (ATL-HPA051400) – 1 Found

Yamanaka, Tomoyuki; Nishiyama, Risa; Shimogori, Tomomi; Nukina, Nobuyuki. Proteomics-Based Approach Identifies Altered ER Domain Properties by ALS-Linked VAPB Mutation. Scientific Reports. 2020;10(1):7610.