Anti REP15 pAb (ATL-HPA059868)

Atlas Antibodies

SKU:
ATL-HPA059868-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: RAB15 effector protein
Gene Name: REP15
Alternative Gene Name: RAB15EP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040121: 68%, ENSRNOG00000001840: 67%
Entrez Gene ID: 387849
Uniprot ID: Q6BDI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEYPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGADWIWTFWGSDKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRV
Gene Sequence FEYPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGADWIWTFWGSDKQIKLQLAVQTLQMSSPPPVESKPCDLSNPESRV
Gene ID - Mouse ENSMUSG00000040121
Gene ID - Rat ENSRNOG00000001840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti REP15 pAb (ATL-HPA059868)
Datasheet Anti REP15 pAb (ATL-HPA059868) Datasheet (External Link)
Vendor Page Anti REP15 pAb (ATL-HPA059868) at Atlas Antibodies

Documents & Links for Anti REP15 pAb (ATL-HPA059868)
Datasheet Anti REP15 pAb (ATL-HPA059868) Datasheet (External Link)
Vendor Page Anti REP15 pAb (ATL-HPA059868)