Anti REN pAb (ATL-HPA005131)

Atlas Antibodies

Catalog No.: ATL-HPA005131-25

Protein Description: renin
Gene Name: REN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070645: 69%, ENSRNOG00000002937: 64%
Entrez Gene ID: 5972
Uniprot ID: P00797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
• Gene Sequence: FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
• Gene ID - Mouse: ENSMUSG00000070645
• Gene ID - Rat: ENSRNOG00000002937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti REN pAb (ATL-HPA005131) – 1 Found

Kukida, Masayoshi; Cai, Lei; Ye, Dien; Sawada, Hisashi; Katsumata, Yuriko; Franklin, Michael K; Hecker, Peter I; Campbell, Kenneth S; Danser, A H Jan; Mullick, Adam E; Daugherty, Alan; Temel, Ryan E; Lu, Hong S. Renal Angiotensinogen Is Predominantly Liver Derived in Nonhuman Primates. Arteriosclerosis, Thrombosis, And Vascular Biology. 2021;41(11):2851-2853.