Anti REG4 pAb (ATL-HPA046555 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046555-25
  • Immunohistochemistry analysis in human duodenum and liver tissues using HPA046555 antibody. Corresponding REG4 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: regenerating islet-derived family, member 4
Gene Name: REG4
Alternative Gene Name: GISP, REG-IV, RELP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027876: 57%, ENSRNOG00000019046: 59%
Entrez Gene ID: 83998
Uniprot ID: Q9BYZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Gene Sequence QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Gene ID - Mouse ENSMUSG00000027876
Gene ID - Rat ENSRNOG00000019046
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti REG4 pAb (ATL-HPA046555 w/enhanced validation)
Datasheet Anti REG4 pAb (ATL-HPA046555 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti REG4 pAb (ATL-HPA046555 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti REG4 pAb (ATL-HPA046555 w/enhanced validation)
Datasheet Anti REG4 pAb (ATL-HPA046555 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti REG4 pAb (ATL-HPA046555 w/enhanced validation)