Anti REG3A pAb (ATL-HPA060705)
Atlas Antibodies
- SKU:
- ATL-HPA060705-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: REG3A
Alternative Gene Name: HIP, PAP, PAP1, PBCGF, REG-III, REG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071356: 70%, ENSRNOG00000006151: 70%
Entrez Gene ID: 5068
Uniprot ID: Q06141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL |
Gene Sequence | YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL |
Gene ID - Mouse | ENSMUSG00000071356 |
Gene ID - Rat | ENSRNOG00000006151 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti REG3A pAb (ATL-HPA060705) | |
Datasheet | Anti REG3A pAb (ATL-HPA060705) Datasheet (External Link) |
Vendor Page | Anti REG3A pAb (ATL-HPA060705) at Atlas Antibodies |
Documents & Links for Anti REG3A pAb (ATL-HPA060705) | |
Datasheet | Anti REG3A pAb (ATL-HPA060705) Datasheet (External Link) |
Vendor Page | Anti REG3A pAb (ATL-HPA060705) |