Protein Description: retinal degeneration 3-like
Gene Name: RD3L
Alternative Gene Name: TDRD9-AS1, TDRD9AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091402: 59%, ENSRNOG00000043031: 60%
Entrez Gene ID: 647286
Uniprot ID: P0DJH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RD3L
Alternative Gene Name: TDRD9-AS1, TDRD9AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091402: 59%, ENSRNOG00000043031: 60%
Entrez Gene ID: 647286
Uniprot ID: P0DJH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNL |
Documents & Links for Anti RD3L pAb (ATL-HPA067971) | |
Datasheet | Anti RD3L pAb (ATL-HPA067971) Datasheet (External Link) |
Vendor Page | Anti RD3L pAb (ATL-HPA067971) at Atlas |
Documents & Links for Anti RD3L pAb (ATL-HPA067971) | |
Datasheet | Anti RD3L pAb (ATL-HPA067971) Datasheet (External Link) |
Vendor Page | Anti RD3L pAb (ATL-HPA067971) |