Anti RCN3 pAb (ATL-HPA050402)

Atlas Antibodies

SKU: ATL-HPA050402-25

• 
• 
• 

Protein Description: reticulocalbin 3, EF-hand calcium binding domain
Gene Name: RCN3
Alternative Gene Name: RLP49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019539: 93%, ENSRNOG00000043007: 97%
Entrez Gene ID: 57333
Uniprot ID: Q96D15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDL
• Gene Sequence: EFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDL
• Gene ID - Mouse: ENSMUSG00000019539
• Gene ID - Rat: ENSRNOG00000043007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.