Anti RCC2 pAb (ATL-HPA072281)

Catalog No:
ATL-HPA072281-25
$401.00
Protein Description: regulator of chromosome condensation 2
Gene Name: RCC2
Alternative Gene Name: TD-60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040945: 93%, ENSRNOG00000006327: 92%
Entrez Gene ID: 55920
Uniprot ID: Q9P258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN

Documents & Links for Anti RCC2 pAb (ATL-HPA072281)
Datasheet Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link)
Vendor Page Anti RCC2 pAb (ATL-HPA072281) at Atlas

Documents & Links for Anti RCC2 pAb (ATL-HPA072281)
Datasheet Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link)
Vendor Page Anti RCC2 pAb (ATL-HPA072281)