Anti RBMY1F pAb (ATL-HPA053147)

Atlas Antibodies

SKU: ATL-HPA053147-25

• 

Protein Description: RNA binding motif protein, Y-linked, family 1, member F
Gene Name: RBMY1F
Alternative Gene Name: MGC33094
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037070: 41%, ENSRNOG00000059347: 43%
Entrez Gene ID: 159163
Uniprot ID: Q15415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGSTCHAYSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREA
• Gene Sequence: GGSTCHAYSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREA
• Gene ID - Mouse: ENSMUSG00000037070
• Gene ID - Rat: ENSRNOG00000059347
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.