Protein Description: RNA binding motif protein 20
Gene Name: RBM20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043639: 77%, ENSRNOG00000014705: 79%
Entrez Gene ID: 282996
Uniprot ID: Q5T481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RBM20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043639: 77%, ENSRNOG00000014705: 79%
Entrez Gene ID: 282996
Uniprot ID: Q5T481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GYYRKEPKAKSDKYLKQQQDAPGRSRRKDEARLRESRHPHPDDSGKEDGLGPKVTRAPEGAKAKQNEKNKTKRTDRDQEGADD |
Documents & Links for Anti RBM20 pAb (ATL-HPA070358) | |
Datasheet | Anti RBM20 pAb (ATL-HPA070358) Datasheet (External Link) |
Vendor Page | Anti RBM20 pAb (ATL-HPA070358) at Atlas |
Documents & Links for Anti RBM20 pAb (ATL-HPA070358) | |
Datasheet | Anti RBM20 pAb (ATL-HPA070358) Datasheet (External Link) |
Vendor Page | Anti RBM20 pAb (ATL-HPA070358) |