Anti RBM15B pAb (ATL-HPA058136)

Atlas Antibodies

SKU: ATL-HPA058136-25

• 

Protein Description: RNA binding motif protein 15B
Gene Name: RBM15B
Alternative Gene Name: HUMAGCGB, OTT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074102: 99%, ENSRNOG00000014161: 98%
Entrez Gene ID: 29890
Uniprot ID: Q8NDT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT
• Gene Sequence: LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT
• Gene ID - Mouse: ENSMUSG00000074102
• Gene ID - Rat: ENSRNOG00000014161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.