Anti RBM15 pAb (ATL-HPA049642)

Atlas Antibodies

SKU: ATL-HPA049642-25

• 
• 

Protein Description: RNA binding motif protein 15
Gene Name: RBM15
Alternative Gene Name: OTT, OTT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048109: 91%, ENSRNOG00000047499: 93%
Entrez Gene ID: 64783
Uniprot ID: Q96T37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHC
• Gene Sequence: RGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHC
• Gene ID - Mouse: ENSMUSG00000048109
• Gene ID - Rat: ENSRNOG00000047499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.