Anti RBM10 pAb (ATL-HPA057372)

Atlas Antibodies

SKU: ATL-HPA057372-25

• 
• 

Protein Description: RNA binding motif protein 10
Gene Name: RBM10
Alternative Gene Name: DXS8237E, GPATC9, GPATCH9, KIAA0122, ZRANB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031060: 98%, ENSRNOG00000008472: 98%
Entrez Gene ID: 8241
Uniprot ID: P98175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST
• Gene Sequence: EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST
• Gene ID - Mouse: ENSMUSG00000031060
• Gene ID - Rat: ENSRNOG00000008472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.