Anti RBL1 pAb (ATL-HPA054962 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054962-25

• 
• 
• 

Protein Description: retinoblastoma-like 1
Gene Name: RBL1
Alternative Gene Name: cp107, p107, PRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027641: 86%, ENSRNOG00000006921: 86%
Entrez Gene ID: 5933
Uniprot ID: P28749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
• Gene Sequence: ESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHER
• Gene ID - Mouse: ENSMUSG00000027641
• Gene ID - Rat: ENSRNOG00000006921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.