Anti RBBP8 pAb (ATL-HPA052946)
Atlas Antibodies
- SKU:
- ATL-HPA052946-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: RBBP8
Alternative Gene Name: COM1, CtIP, RIM, SCKL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041238: 60%, ENSRNOG00000012899: 59%
Entrez Gene ID: 5932
Uniprot ID: Q99708
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE |
Gene Sequence | FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE |
Gene ID - Mouse | ENSMUSG00000041238 |
Gene ID - Rat | ENSRNOG00000012899 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBBP8 pAb (ATL-HPA052946) | |
Datasheet | Anti RBBP8 pAb (ATL-HPA052946) Datasheet (External Link) |
Vendor Page | Anti RBBP8 pAb (ATL-HPA052946) at Atlas Antibodies |
Documents & Links for Anti RBBP8 pAb (ATL-HPA052946) | |
Datasheet | Anti RBBP8 pAb (ATL-HPA052946) Datasheet (External Link) |
Vendor Page | Anti RBBP8 pAb (ATL-HPA052946) |