Anti RBBP4 pAb (ATL-HPA060724)

Atlas Antibodies

SKU: ATL-HPA060724-25

• 
• 
• 

Protein Description: retinoblastoma binding protein 4
Gene Name: RBBP4
Alternative Gene Name: lin-53, NURF55, RbAp48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057236: 100%, ENSRNOG00000021492: 100%
Entrez Gene ID: 5928
Uniprot ID: Q09028
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA
• Gene Sequence: QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA
• Gene ID - Mouse: ENSMUSG00000057236
• Gene ID - Rat: ENSRNOG00000021492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.