Anti RB1CC1 pAb (ATL-HPA053049)

Atlas Antibodies

SKU:
ATL-HPA053049-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RB1-inducible coiled-coil 1
Gene Name: RB1CC1
Alternative Gene Name: ATG17, Cc1, DRAGOU14, FIP200, KIAA0203, PPP1R131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025907: 95%, ENSRNOG00000006833: 93%
Entrez Gene ID: 9821
Uniprot ID: Q8TDY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSP
Gene Sequence QGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAETKRSTELVLSP
Gene ID - Mouse ENSMUSG00000025907
Gene ID - Rat ENSRNOG00000006833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RB1CC1 pAb (ATL-HPA053049)
Datasheet Anti RB1CC1 pAb (ATL-HPA053049) Datasheet (External Link)
Vendor Page Anti RB1CC1 pAb (ATL-HPA053049) at Atlas Antibodies

Documents & Links for Anti RB1CC1 pAb (ATL-HPA053049)
Datasheet Anti RB1CC1 pAb (ATL-HPA053049) Datasheet (External Link)
Vendor Page Anti RB1CC1 pAb (ATL-HPA053049)



Citations for Anti RB1CC1 pAb (ATL-HPA053049) – 1 Found
Turco, Eleonora; Witt, Marie; Abert, Christine; Bock-Bierbaum, Tobias; Su, Ming-Yuan; Trapannone, Riccardo; Sztacho, Martin; Danieli, Alberto; Shi, Xiaoshan; Zaffagnini, Gabriele; Gamper, Annamaria; Schuschnig, Martina; Fracchiolla, Dorotea; Bernklau, Daniel; Romanov, Julia; Hartl, Markus; Hurley, James H; Daumke, Oliver; Martens, Sascha. FIP200 Claw Domain Binding to p62 Promotes Autophagosome Formation at Ubiquitin Condensates. Molecular Cell. 2019;74(2):330-346.e11.  PubMed