Anti RAX2 pAb (ATL-HPA052533)

Atlas Antibodies

SKU: ATL-HPA052533-25

• 

Protein Description: retina and anterior neural fold homeobox 2
Gene Name: RAX2
Alternative Gene Name: ARMD6, CORD11, MGC15631, RAXL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035522: 42%, ENSRNOG00000033520: 39%
Entrez Gene ID: 84839
Uniprot ID: Q96IS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG
• Gene Sequence: ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG
• Gene ID - Mouse: ENSMUSG00000035522
• Gene ID - Rat: ENSRNOG00000033520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.