Anti RAVER1 pAb (ATL-HPA043575 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043575-25

• 

Product Description

Protein Description: ribonucleoprotein, PTB-binding 1
Gene Name: RAVER1
Alternative Gene Name: KIAA1978
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111497: 93%, ENSRNOG00000020710: 93%
Entrez Gene ID: 125950
Uniprot ID: Q8IY67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAE
• Gene Sequence: KSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAE
• Gene ID - Mouse: ENSMUSG00000111497
• Gene ID - Rat: ENSRNOG00000020710
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links