Anti RASSF7 pAb (ATL-HPA078015)

Atlas Antibodies

SKU:
ATL-HPA078015-25
  • Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 7
Gene Name: RASSF7
Alternative Gene Name: C11orf13, HRAS1, HRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038618: 71%, ENSRNOG00000017109: 70%
Entrez Gene ID: 8045
Uniprot ID: Q02833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
Gene Sequence QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
Gene ID - Mouse ENSMUSG00000038618
Gene ID - Rat ENSRNOG00000017109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RASSF7 pAb (ATL-HPA078015)
Datasheet Anti RASSF7 pAb (ATL-HPA078015) Datasheet (External Link)
Vendor Page Anti RASSF7 pAb (ATL-HPA078015) at Atlas Antibodies

Documents & Links for Anti RASSF7 pAb (ATL-HPA078015)
Datasheet Anti RASSF7 pAb (ATL-HPA078015) Datasheet (External Link)
Vendor Page Anti RASSF7 pAb (ATL-HPA078015)