Protein Description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 7
Gene Name: RASSF7
Alternative Gene Name: C11orf13, HRAS1, HRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038618: 71%, ENSRNOG00000017109: 70%
Entrez Gene ID: 8045
Uniprot ID: Q02833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RASSF7
Alternative Gene Name: C11orf13, HRAS1, HRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038618: 71%, ENSRNOG00000017109: 70%
Entrez Gene ID: 8045
Uniprot ID: Q02833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP |
Gene ID - Mouse | ENSMUSG00000038618 |
Gene ID - Rat | ENSMUSG00000038618 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RASSF7 pAb (ATL-HPA078015) | |
Datasheet | Anti RASSF7 pAb (ATL-HPA078015) Datasheet (External Link) |
Vendor Page | Anti RASSF7 pAb (ATL-HPA078015) at Atlas |
Documents & Links for Anti RASSF7 pAb (ATL-HPA078015) | |
Datasheet | Anti RASSF7 pAb (ATL-HPA078015) Datasheet (External Link) |
Vendor Page | Anti RASSF7 pAb (ATL-HPA078015) |