Anti RASL11A pAb (ATL-HPA053296)
Atlas Antibodies
- SKU:
- ATL-HPA053296-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RASL11A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029641: 90%, ENSRNOG00000000956: 92%
Entrez Gene ID: 387496
Uniprot ID: Q6T310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQH |
Gene Sequence | YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQH |
Gene ID - Mouse | ENSMUSG00000029641 |
Gene ID - Rat | ENSRNOG00000000956 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RASL11A pAb (ATL-HPA053296) | |
Datasheet | Anti RASL11A pAb (ATL-HPA053296) Datasheet (External Link) |
Vendor Page | Anti RASL11A pAb (ATL-HPA053296) at Atlas Antibodies |
Documents & Links for Anti RASL11A pAb (ATL-HPA053296) | |
Datasheet | Anti RASL11A pAb (ATL-HPA053296) Datasheet (External Link) |
Vendor Page | Anti RASL11A pAb (ATL-HPA053296) |