Anti RASL10A pAb (ATL-HPA056169)

Atlas Antibodies

SKU:
ATL-HPA056169-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAS-like, family 10, member A
Gene Name: RASL10A
Alternative Gene Name: RRP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034209: 95%, ENSRNOG00000008951: 98%
Entrez Gene ID: 10633
Uniprot ID: Q92737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM
Gene Sequence AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM
Gene ID - Mouse ENSMUSG00000034209
Gene ID - Rat ENSRNOG00000008951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RASL10A pAb (ATL-HPA056169)
Datasheet Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link)
Vendor Page Anti RASL10A pAb (ATL-HPA056169) at Atlas Antibodies

Documents & Links for Anti RASL10A pAb (ATL-HPA056169)
Datasheet Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link)
Vendor Page Anti RASL10A pAb (ATL-HPA056169)