Anti RASA3 pAb (ATL-HPA046759)

Atlas Antibodies

SKU:
ATL-HPA046759-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAS p21 protein activator 3
Gene Name: RASA3
Alternative Gene Name: GAP1IP4BP, GAPIII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031453: 95%, ENSRNOG00000017671: 92%
Entrez Gene ID: 22821
Uniprot ID: Q14644
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQE
Gene Sequence LFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQE
Gene ID - Mouse ENSMUSG00000031453
Gene ID - Rat ENSRNOG00000017671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RASA3 pAb (ATL-HPA046759)
Datasheet Anti RASA3 pAb (ATL-HPA046759) Datasheet (External Link)
Vendor Page Anti RASA3 pAb (ATL-HPA046759) at Atlas Antibodies

Documents & Links for Anti RASA3 pAb (ATL-HPA046759)
Datasheet Anti RASA3 pAb (ATL-HPA046759) Datasheet (External Link)
Vendor Page Anti RASA3 pAb (ATL-HPA046759)