Anti RAPGEF4 pAb (ATL-HPA028968)

Atlas Antibodies

SKU:
ATL-HPA028968-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to focal adhesion sites.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Rap guanine nucleotide exchange factor (GEF) 4
Gene Name: RAPGEF4
Alternative Gene Name: cAMP-GEFII, CGEF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049044: 97%, ENSRNOG00000001516: 98%
Entrez Gene ID: 11069
Uniprot ID: Q8WZA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
Gene Sequence VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
Gene ID - Mouse ENSMUSG00000049044
Gene ID - Rat ENSRNOG00000001516
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAPGEF4 pAb (ATL-HPA028968)
Datasheet Anti RAPGEF4 pAb (ATL-HPA028968) Datasheet (External Link)
Vendor Page Anti RAPGEF4 pAb (ATL-HPA028968) at Atlas Antibodies

Documents & Links for Anti RAPGEF4 pAb (ATL-HPA028968)
Datasheet Anti RAPGEF4 pAb (ATL-HPA028968) Datasheet (External Link)
Vendor Page Anti RAPGEF4 pAb (ATL-HPA028968)