Anti RANGAP1 pAb (ATL-HPA050110 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050110-25
  • Immunohistochemical staining of human testis shows strong nuclear membranous positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane, cytosol & vesicles.
  • Western blot analysis using Anti-RANGAP1 antibody HPA050110 (A) shows similar pattern to independent antibody HPA062034 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Ran GTPase activating protein 1
Gene Name: RANGAP1
Alternative Gene Name: Fug1, KIAA1835, SD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022391: 96%, ENSRNOG00000031789: 95%
Entrez Gene ID: 5905
Uniprot ID: P46060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGE
Gene Sequence ETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGE
Gene ID - Mouse ENSMUSG00000022391
Gene ID - Rat ENSRNOG00000031789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti RANGAP1 pAb (ATL-HPA050110 w/enhanced validation)
Datasheet Anti RANGAP1 pAb (ATL-HPA050110 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RANGAP1 pAb (ATL-HPA050110 w/enhanced validation)