Anti RALYL pAb (ATL-HPA055868 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055868-25

• 

Protein Description: RALY RNA binding protein-like
Gene Name: RALYL
Alternative Gene Name: HNRPCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039717: 85%, ENSRNOG00000013587: 36%
Entrez Gene ID: 138046
Uniprot ID: Q86SE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
• Gene Sequence: SLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
• Gene ID - Mouse: ENSMUSG00000039717
• Gene ID - Rat: ENSRNOG00000013587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.