Anti RALGAPB pAb (ATL-HPA051454)

Atlas Antibodies

SKU:
ATL-HPA051454-25
  • Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Ral GTPase activating protein, beta subunit (non-catalytic)
Gene Name: RALGAPB
Alternative Gene Name: DKFZp781M2411, KIAA1219, RalGAPbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027652: 91%, ENSRNOG00000014836: 94%
Entrez Gene ID: 57148
Uniprot ID: Q86X10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
Gene Sequence LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
Gene ID - Mouse ENSMUSG00000027652
Gene ID - Rat ENSRNOG00000014836
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RALGAPB pAb (ATL-HPA051454)
Datasheet Anti RALGAPB pAb (ATL-HPA051454) Datasheet (External Link)
Vendor Page Anti RALGAPB pAb (ATL-HPA051454) at Atlas Antibodies

Documents & Links for Anti RALGAPB pAb (ATL-HPA051454)
Datasheet Anti RALGAPB pAb (ATL-HPA051454) Datasheet (External Link)
Vendor Page Anti RALGAPB pAb (ATL-HPA051454)