Anti RALBP1 pAb (ATL-HPA046651)

Atlas Antibodies

SKU:
ATL-HPA046651-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ralA binding protein 1
Gene Name: RALBP1
Alternative Gene Name: RIP, RIP1, RLIP76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024096: 98%, ENSRNOG00000013461: 97%
Entrez Gene ID: 10928
Uniprot ID: Q15311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTE
Gene Sequence VQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTE
Gene ID - Mouse ENSMUSG00000024096
Gene ID - Rat ENSRNOG00000013461
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RALBP1 pAb (ATL-HPA046651)
Datasheet Anti RALBP1 pAb (ATL-HPA046651) Datasheet (External Link)
Vendor Page Anti RALBP1 pAb (ATL-HPA046651) at Atlas Antibodies

Documents & Links for Anti RALBP1 pAb (ATL-HPA046651)
Datasheet Anti RALBP1 pAb (ATL-HPA046651) Datasheet (External Link)
Vendor Page Anti RALBP1 pAb (ATL-HPA046651)