Anti RAI1 pAb (ATL-HPA054906)

Atlas Antibodies

SKU:
ATL-HPA054906-25
  • Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: retinoic acid induced 1
Gene Name: RAI1
Alternative Gene Name: DKFZP434A139, KIAA1820, MGC12824, SMCR, SMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062115: 65%, ENSRNOG00000060615: 66%
Entrez Gene ID: 10743
Uniprot ID: Q7Z5J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPAL
Gene Sequence TSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPAL
Gene ID - Mouse ENSMUSG00000062115
Gene ID - Rat ENSRNOG00000060615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAI1 pAb (ATL-HPA054906)
Datasheet Anti RAI1 pAb (ATL-HPA054906) Datasheet (External Link)
Vendor Page Anti RAI1 pAb (ATL-HPA054906) at Atlas Antibodies

Documents & Links for Anti RAI1 pAb (ATL-HPA054906)
Datasheet Anti RAI1 pAb (ATL-HPA054906) Datasheet (External Link)
Vendor Page Anti RAI1 pAb (ATL-HPA054906)