Anti RAE1 pAb (ATL-HPA048795)
Atlas Antibodies
- SKU:
- ATL-HPA048795-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RAE1
Alternative Gene Name: Mnrp41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027509: 99%, ENSRNOG00000021295: 96%
Entrez Gene ID: 8480
Uniprot ID: P78406
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK |
Gene Sequence | VHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK |
Gene ID - Mouse | ENSMUSG00000027509 |
Gene ID - Rat | ENSRNOG00000021295 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAE1 pAb (ATL-HPA048795) | |
Datasheet | Anti RAE1 pAb (ATL-HPA048795) Datasheet (External Link) |
Vendor Page | Anti RAE1 pAb (ATL-HPA048795) at Atlas Antibodies |
Documents & Links for Anti RAE1 pAb (ATL-HPA048795) | |
Datasheet | Anti RAE1 pAb (ATL-HPA048795) Datasheet (External Link) |
Vendor Page | Anti RAE1 pAb (ATL-HPA048795) |
Citations for Anti RAE1 pAb (ATL-HPA048795) – 1 Found |
Meyers, Jordan M; Ramanathan, Muthukumar; Shanderson, Ronald L; Beck, Aimee; Donohue, Laura; Ferguson, Ian; Guo, Margaret G; Rao, Deepti S; Miao, Weili; Reynolds, David; Yang, Xue; Zhao, Yang; Yang, Yen-Yu; Blish, Catherine; Wang, Yinsheng; Khavari, Paul A. The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation. Plos Pathogens. 2021;17(10):e1009412. PubMed |