Anti RADIL pAb (ATL-HPA051776)

Atlas Antibodies

SKU: ATL-HPA051776-25

• 
• 

Protein Description: Ras association and DIL domains
Gene Name: RADIL
Alternative Gene Name: FLJ10324, KIAA1849, RASIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029576: 93%, ENSRNOG00000024456: 95%
Entrez Gene ID: 55698
Uniprot ID: Q96JH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA
• Gene Sequence: YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA
• Gene ID - Mouse: ENSMUSG00000029576
• Gene ID - Rat: ENSRNOG00000024456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.