Anti RAD51B pAb (ATL-HPA051869)

Atlas Antibodies

SKU:
ATL-HPA051869-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAD51 paralog B
Gene Name: RAD51B
Alternative Gene Name: hREC2, R51H2, RAD51L1, REC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033444: 25%, ENSRNOG00000045612: 32%
Entrez Gene ID: 5890
Uniprot ID: O15315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI
Gene Sequence SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI
Gene ID - Mouse ENSMUSG00000033444
Gene ID - Rat ENSRNOG00000045612
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti RAD51B pAb (ATL-HPA051869)
Datasheet Anti RAD51B pAb (ATL-HPA051869) Datasheet (External Link)
Vendor Page Anti RAD51B pAb (ATL-HPA051869) at Atlas Antibodies

Documents & Links for Anti RAD51B pAb (ATL-HPA051869)
Datasheet Anti RAD51B pAb (ATL-HPA051869) Datasheet (External Link)
Vendor Page Anti RAD51B pAb (ATL-HPA051869)