Protein Description: RAD23 homolog A (S. cerevisiae)
Gene Name: RAD23A
Alternative Gene Name: HHR23A, MGC111083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003813: 95%, ENSRNOG00000003026: 93%
Entrez Gene ID: 5886
Uniprot ID: P54725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAD23A
Alternative Gene Name: HHR23A, MGC111083
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003813: 95%, ENSRNOG00000003026: 93%
Entrez Gene ID: 5886
Uniprot ID: P54725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQ |
| Documents & Links for Anti RAD23A pAb (ATL-HPA065599) | |
| Datasheet | Anti RAD23A pAb (ATL-HPA065599) Datasheet (External Link) |
| Vendor Page | Anti RAD23A pAb (ATL-HPA065599) at Atlas |
| Documents & Links for Anti RAD23A pAb (ATL-HPA065599) | |
| Datasheet | Anti RAD23A pAb (ATL-HPA065599) Datasheet (External Link) |
| Vendor Page | Anti RAD23A pAb (ATL-HPA065599) |